PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011092692.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 303aa    MW: 35022 Da    PI: 6.8717
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011092692.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF42.21e-131052244
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                     i+n++ r+ tf kR++g+  K  E  +LCd+++++ii++++ 
  XP_011092692.1 10 LISNERSRTLTFKKRKEGLTRKLREFTTLCDVNACMIIYGPKP 52
                    59**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-13161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.156154IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.02E-18171IPR002100Transcription factor, MADS-box
CDDcd002665.55E-21278No hitNo description
PRINTSPR004042.8E-8323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-141151IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MGRAKLKMEL ISNERSRTLT FKKRKEGLTR KLREFTTLCD VNACMIIYGP KPEIGPEIWP  60
QNNPDEVRRM IQVYSARNRD SGSKSFGLPD FFNDRKRKLE EEFVKLRRKN LEAKYPTWFE  120
FLNDLSEAQL RDFAVGLKNK AGSVKSRIEF LKCSRNDNPG LEFDQLMMDA ARLNQFYNLN  180
QQQQISSVDH HHDHHVQCAN QDPLMMMLMM NENNDQLIGA AAGSFDHQDN VFYGMEPTGP  240
VGPVICYGPT PVEQYYTPPP MALPLSLPPP PYIPVMSRLQ FSTMENYYHD GAALEDIFQD  300
MIR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104109KLRRKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011092692.10.0PREDICTED: MADS-box transcription factor PHERES 2-like
TrEMBLS8DGW35e-75S8DGW3_9LAMI; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24572253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-22M-type_MADS family protein